Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3384855..3385656 Replicon chromosome
Accession NZ_CP124385
Organism Escherichia coli strain AVS0153

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QJP67_RS16610 Protein ID WP_001094436.1
Coordinates 3384855..3385232 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QJP67_RS16615 Protein ID WP_015953067.1
Coordinates 3385279..3385656 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP67_RS16580 (3380814) 3380814..3380975 - 162 Protein_3242 DUF4942 domain-containing protein -
QJP67_RS16585 (3381066) 3381066..3382565 + 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
QJP67_RS16590 (3382562) 3382562..3383317 + 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
QJP67_RS16595 (3383366) 3383366..3384076 - 711 WP_001621817.1 DUF4942 domain-containing protein -
QJP67_RS16600 (3384161) 3384161..3384358 - 198 WP_000839254.1 DUF957 domain-containing protein -
QJP67_RS16605 (3384370) 3384370..3384858 - 489 WP_000761714.1 DUF5983 family protein -
QJP67_RS16610 (3384855) 3384855..3385232 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QJP67_RS16615 (3385279) 3385279..3385656 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP67_RS16620 (3385735) 3385735..3385956 - 222 WP_000692312.1 DUF987 domain-containing protein -
QJP67_RS16625 (3386025) 3386025..3386501 - 477 WP_001186756.1 RadC family protein -
QJP67_RS16630 (3386516) 3386516..3387001 - 486 WP_029700724.1 antirestriction protein -
QJP67_RS16635 (3387093) 3387093..3387911 - 819 WP_001175163.1 DUF932 domain-containing protein -
QJP67_RS16640 (3388001) 3388001..3388234 - 234 WP_001278287.1 DUF905 family protein -
QJP67_RS16645 (3388240) 3388240..3388917 - 678 WP_001097301.1 hypothetical protein -
QJP67_RS16650 (3389065) 3389065..3389745 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T279962 WP_001094436.1 NZ_CP124385:c3385232-3384855 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT279962 WP_015953067.1 NZ_CP124385:c3385656-3385279 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References