Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 866225..867056 | Replicon | chromosome |
| Accession | NZ_CP124385 | ||
| Organism | Escherichia coli strain AVS0153 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | QJP67_RS04580 | Protein ID | WP_000854815.1 |
| Coordinates | 866682..867056 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | QJP67_RS04575 | Protein ID | WP_001280918.1 |
| Coordinates | 866225..866593 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP67_RS04530 (861314) | 861314..862060 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP67_RS04535 (862143) | 862143..862493 | + | 351 | Protein_895 | hypothetical protein | - |
| QJP67_RS04540 (862509) | 862509..862919 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| QJP67_RS04545 (863140) | 863140..863958 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| QJP67_RS04550 (863958) | 863958..864203 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| QJP67_RS04555 (864297) | 864297..864770 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| QJP67_RS04560 (864786) | 864786..865262 | + | 477 | WP_001186200.1 | RadC family protein | - |
| QJP67_RS04565 (865325) | 865325..865546 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP67_RS04570 (865565) | 865565..866209 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| QJP67_RS04575 (866225) | 866225..866593 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP67_RS04580 (866682) | 866682..867056 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP67_RS04585 (867053) | 867053..867247 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QJP67_RS04590 (867293) | 867293..867373 | + | 81 | Protein_906 | hypothetical protein | - |
| QJP67_RS04595 (867662) | 867662..867742 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP67_RS04600 (867721) | 867721..868044 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
| QJP67_RS04605 (868145) | 868145..868474 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP67_RS04610 (868646) | 868646..869704 | - | 1059 | WP_001200889.1 | FUSC family protein | - |
| QJP67_RS04615 (869902) | 869902..870375 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
| QJP67_RS04620 (870494) | 870494..871660 | - | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T279953 WP_000854815.1 NZ_CP124385:866682-867056 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |