Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 866225..867056 Replicon chromosome
Accession NZ_CP124385
Organism Escherichia coli strain AVS0153

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP67_RS04580 Protein ID WP_000854815.1
Coordinates 866682..867056 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP67_RS04575 Protein ID WP_001280918.1
Coordinates 866225..866593 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP67_RS04530 (861314) 861314..862060 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP67_RS04535 (862143) 862143..862493 + 351 Protein_895 hypothetical protein -
QJP67_RS04540 (862509) 862509..862919 + 411 WP_000846703.1 hypothetical protein -
QJP67_RS04545 (863140) 863140..863958 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP67_RS04550 (863958) 863958..864203 + 246 WP_001164966.1 hypothetical protein -
QJP67_RS04555 (864297) 864297..864770 + 474 WP_001542276.1 antirestriction protein -
QJP67_RS04560 (864786) 864786..865262 + 477 WP_001186200.1 RadC family protein -
QJP67_RS04565 (865325) 865325..865546 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP67_RS04570 (865565) 865565..866209 + 645 WP_000086752.1 hypothetical protein -
QJP67_RS04575 (866225) 866225..866593 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP67_RS04580 (866682) 866682..867056 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP67_RS04585 (867053) 867053..867247 + 195 WP_000988600.1 DUF5983 family protein -
QJP67_RS04590 (867293) 867293..867373 + 81 Protein_906 hypothetical protein -
QJP67_RS04595 (867662) 867662..867742 - 81 WP_023441679.1 hypothetical protein -
QJP67_RS04600 (867721) 867721..868044 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP67_RS04605 (868145) 868145..868474 - 330 WP_000450409.1 DUF496 family protein -
QJP67_RS04610 (868646) 868646..869704 - 1059 WP_001200889.1 FUSC family protein -
QJP67_RS04615 (869902) 869902..870375 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP67_RS04620 (870494) 870494..871660 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279953 WP_000854815.1 NZ_CP124385:866682-867056 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279953 WP_001280918.1 NZ_CP124385:866225-866593 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References