Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 63137..63738 | Replicon | plasmid pAVS0578-B |
Accession | NZ_CP124376 | ||
Organism | Escherichia coli strain AVS0578 |
Toxin (Protein)
Gene name | doc | Uniprot ID | F4TND7 |
Locus tag | QJP97_RS26275 | Protein ID | WP_001216030.1 |
Coordinates | 63137..63517 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QJP97_RS26280 | Protein ID | WP_001190712.1 |
Coordinates | 63517..63738 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP97_RS26250 (QJP97_26245) | 58577..60061 | - | 1485 | WP_000124150.1 | terminase | - |
QJP97_RS26255 (QJP97_26250) | 60061..61254 | - | 1194 | WP_282526075.1 | terminase | - |
QJP97_RS26260 (QJP97_26255) | 61341..61793 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
QJP97_RS26265 (QJP97_26260) | 61882..62925 | - | 1044 | WP_282526076.1 | DUF968 domain-containing protein | - |
QJP97_RS26270 (QJP97_26265) | 62953..63132 | - | 180 | WP_000113018.1 | hypothetical protein | - |
QJP97_RS26275 (QJP97_26270) | 63137..63517 | - | 381 | WP_001216030.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QJP97_RS26280 (QJP97_26275) | 63517..63738 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QJP97_RS26285 (QJP97_26280) | 63811..64200 | - | 390 | WP_000506726.1 | S24 family peptidase | - |
QJP97_RS26290 (QJP97_26285) | 64324..64575 | - | 252 | WP_046644566.1 | DNA polymerase III subunit theta | - |
QJP97_RS26295 (QJP97_26290) | 65025..65162 | + | 138 | WP_000123562.1 | hypothetical protein | - |
QJP97_RS26300 (QJP97_26295) | 65237..65599 | - | 363 | WP_001261544.1 | hypothetical protein | - |
QJP97_RS26305 (QJP97_26300) | 65596..66489 | - | 894 | WP_282526081.1 | hypothetical protein | - |
QJP97_RS26310 (QJP97_26305) | 66463..66588 | - | 126 | Protein_68 | hypothetical protein | - |
QJP97_RS26315 (QJP97_26310) | 66599..66862 | - | 264 | WP_000224227.1 | hypothetical protein | - |
QJP97_RS26320 (QJP97_26315) | 67083..67232 | - | 150 | Protein_70 | hypothetical protein | - |
QJP97_RS26325 (QJP97_26320) | 67229..67438 | - | 210 | WP_023156633.1 | hypothetical protein | - |
QJP97_RS26330 (QJP97_26325) | 67440..67628 | - | 189 | WP_000797279.1 | hypothetical protein | - |
QJP97_RS26335 (QJP97_26330) | 67977..68423 | - | 447 | WP_023156632.1 | ead/Ea22-like family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..94894 | 94894 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13601.29 Da Isoelectric Point: 5.1408
>T279946 WP_001216030.1 NZ_CP124376:c63517-63137 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1W8Q3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |