Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 75294..75819 | Replicon | plasmid unnamed |
| Accession | NZ_CP124375 | ||
| Organism | Escherichia coli strain AVS0578 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QJP97_RS25810 | Protein ID | WP_001159868.1 |
| Coordinates | 75514..75819 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QJP97_RS25805 | Protein ID | WP_000813634.1 |
| Coordinates | 75294..75512 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP97_RS25780 (70573) | 70573..72186 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP97_RS25785 (72217) | 72217..72567 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP97_RS25790 (72564) | 72564..72989 | - | 426 | WP_000422741.1 | transposase | - |
| QJP97_RS25795 (73081) | 73081..74202 | + | 1122 | WP_012783980.1 | DUF3800 domain-containing protein | - |
| QJP97_RS25800 (74236) | 74236..74748 | - | 513 | WP_000151784.1 | hypothetical protein | - |
| QJP97_RS25805 (75294) | 75294..75512 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJP97_RS25810 (75514) | 75514..75819 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJP97_RS25815 (75820) | 75820..76626 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| QJP97_RS25820 (77400) | 77400..78155 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP97_RS25825 (78743) | 78743..79909 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) | - | 1..99789 | 99789 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T279943 WP_001159868.1 NZ_CP124375:75514-75819 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|