Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 68168..68811 Replicon plasmid unnamed
Accession NZ_CP124375
Organism Escherichia coli strain AVS0578

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QJP97_RS25760 Protein ID WP_001034046.1
Coordinates 68168..68584 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QJP97_RS25765 Protein ID WP_001261278.1
Coordinates 68581..68811 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP97_RS25745 (63305) 63305..63721 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QJP97_RS25750 (63718) 63718..63948 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QJP97_RS25755 (64329) 64329..68123 + 3795 WP_001144732.1 hypothetical protein -
QJP97_RS25760 (68168) 68168..68584 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QJP97_RS25765 (68581) 68581..68811 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QJP97_RS25770 (69076) 69076..69576 + 501 WP_000528932.1 HEPN family nuclease -
QJP97_RS25775 (69589) 69589..70362 + 774 WP_000905949.1 hypothetical protein -
QJP97_RS25780 (70573) 70573..72186 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
QJP97_RS25785 (72217) 72217..72567 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
QJP97_RS25790 (72564) 72564..72989 - 426 WP_000422741.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) - 1..99789 99789


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T279942 WP_001034046.1 NZ_CP124375:c68584-68168 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT279942 WP_001261278.1 NZ_CP124375:c68811-68581 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References