Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 63305..63948 Replicon plasmid unnamed
Accession NZ_CP124375
Organism Escherichia coli strain AVS0578

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QJP97_RS25745 Protein ID WP_001034044.1
Coordinates 63305..63721 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QJP97_RS25750 Protein ID WP_001261286.1
Coordinates 63718..63948 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP97_RS25720 (59150) 59150..59418 + 269 Protein_70 type II toxin-antitoxin system ParD family antitoxin -
QJP97_RS25725 (59405) 59405..59673 + 269 Protein_71 type II toxin-antitoxin system RelE/ParE family toxin -
QJP97_RS25730 (59707) 59707..60404 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
QJP97_RS25735 (60658) 60658..61680 - 1023 WP_000361402.1 helicase UvrD -
QJP97_RS25740 (61665) 61665..63230 - 1566 WP_001128474.1 AAA family ATPase -
QJP97_RS25745 (63305) 63305..63721 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QJP97_RS25750 (63718) 63718..63948 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QJP97_RS25755 (64329) 64329..68123 + 3795 WP_001144732.1 hypothetical protein -
QJP97_RS25760 (68168) 68168..68584 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
QJP97_RS25765 (68581) 68581..68811 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) - 1..99789 99789


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T279941 WP_001034044.1 NZ_CP124375:c63721-63305 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT279941 WP_001261286.1 NZ_CP124375:c63948-63718 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References