Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 56295..56854 Replicon plasmid unnamed
Accession NZ_CP124375
Organism Escherichia coli strain AVS0578

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag QJP97_RS25700 Protein ID WP_000421272.1
Coordinates 56579..56854 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag QJP97_RS25695 Protein ID WP_001387467.1
Coordinates 56295..56579 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP97_RS25670 (51352) 51352..52965 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
QJP97_RS25675 (53001) 53001..53489 + 489 WP_282526073.1 dihydrodipicolinate synthase family protein -
QJP97_RS25680 (53514) 53514..53894 + 381 WP_000710783.1 Rid family detoxifying hydrolase -
QJP97_RS25685 (53927) 53927..54892 + 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
QJP97_RS25690 (54938) 54938..55690 - 753 WP_000562172.1 IclR family transcriptional regulator -
QJP97_RS25695 (56295) 56295..56579 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
QJP97_RS25700 (56579) 56579..56854 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QJP97_RS25705 (56960) 56960..57163 + 204 Protein_67 hypothetical protein -
QJP97_RS25710 (57288) 57288..57416 - 129 Protein_68 IS481 family transposase -
QJP97_RS25715 (57449) 57449..58618 - 1170 WP_001072355.1 hypothetical protein -
QJP97_RS25720 (59150) 59150..59418 + 269 Protein_70 type II toxin-antitoxin system ParD family antitoxin -
QJP97_RS25725 (59405) 59405..59673 + 269 Protein_71 type II toxin-antitoxin system RelE/ParE family toxin -
QJP97_RS25730 (59707) 59707..60404 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
QJP97_RS25735 (60658) 60658..61680 - 1023 WP_000361402.1 helicase UvrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) - 1..99789 99789


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T279940 WP_000421272.1 NZ_CP124375:56579-56854 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT279940 WP_001387467.1 NZ_CP124375:56295-56579 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References