Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4864643..4865478 | Replicon | chromosome |
| Accession | NZ_CP124374 | ||
| Organism | Escherichia coli strain AVS0578 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A376WVB1 |
| Locus tag | QJP97_RS23945 | Protein ID | WP_001094448.1 |
| Coordinates | 4865101..4865478 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3T7EC32 |
| Locus tag | QJP97_RS23940 | Protein ID | WP_024175935.1 |
| Coordinates | 4864643..4865011 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP97_RS23915 (4862072) | 4862072..4862305 | + | 234 | WP_001117568.1 | DUF905 family protein | - |
| QJP97_RS23920 (4862396) | 4862396..4863214 | + | 819 | WP_001234753.1 | DUF932 domain-containing protein | - |
| QJP97_RS23925 (4863306) | 4863306..4863791 | + | 486 | WP_000214415.1 | antirestriction protein | - |
| QJP97_RS23930 (4863803) | 4863803..4864279 | + | 477 | WP_001186709.1 | RadC family protein | - |
| QJP97_RS23935 (4864348) | 4864348..4864569 | + | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| QJP97_RS23940 (4864643) | 4864643..4865011 | + | 369 | WP_024175935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP97_RS23945 (4865101) | 4865101..4865478 | + | 378 | WP_001094448.1 | TA system toxin CbtA family protein | Toxin |
| QJP97_RS23950 (4865475) | 4865475..4865963 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QJP97_RS23955 (4865975) | 4865975..4866167 | + | 193 | Protein_4695 | hypothetical protein | - |
| QJP97_RS23960 (4866252) | 4866252..4867097 | + | 846 | WP_000065751.1 | DUF4942 domain-containing protein | - |
| QJP97_RS23965 (4867690) | 4867690..4868187 | + | 498 | WP_000509815.1 | hypothetical protein | - |
| QJP97_RS23970 (4868365) | 4868365..4869288 | + | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| QJP97_RS23975 (4869292) | 4869292..4870110 | - | 819 | WP_000779409.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4857112..4868187 | 11075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14221.22 Da Isoelectric Point: 8.2919
>T279938 WP_001094448.1 NZ_CP124374:4865101-4865478 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13598.40 Da Isoelectric Point: 6.6255
>AT279938 WP_024175935.1 NZ_CP124374:4864643-4865011 [Escherichia coli]
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A376WVB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T7EC32 |