Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 4555145..4555945 | Replicon | chromosome |
| Accession | NZ_CP124374 | ||
| Organism | Escherichia coli strain AVS0578 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4T503 |
| Locus tag | QJP97_RS22535 | Protein ID | WP_000342452.1 |
| Coordinates | 4555145..4555672 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4T504 |
| Locus tag | QJP97_RS22540 | Protein ID | WP_001277107.1 |
| Coordinates | 4555679..4555945 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP97_RS22510 (4550221) | 4550221..4550988 | - | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QJP97_RS22515 (4550985) | 4550985..4552262 | - | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
| QJP97_RS22520 (4552259) | 4552259..4553185 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QJP97_RS22525 (4553233) | 4553233..4554342 | - | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| QJP97_RS22530 (4554765) | 4554765..4555148 | + | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| QJP97_RS22535 (4555145) | 4555145..4555672 | - | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| QJP97_RS22540 (4555679) | 4555679..4555945 | - | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| QJP97_RS22545 (4556094) | 4556094..4557197 | - | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| QJP97_RS22550 (4557468) | 4557468..4558322 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| QJP97_RS22555 (4558567) | 4558567..4559625 | - | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
| QJP97_RS22560 (4559618) | 4559618..4560286 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T279937 WP_000342452.1 NZ_CP124374:c4555672-4555145 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061K5K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061YQ57 |