Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4026599..4027433 | Replicon | chromosome |
Accession | NZ_CP124374 | ||
Organism | Escherichia coli strain AVS0578 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PLF5 |
Locus tag | QJP97_RS19905 | Protein ID | WP_000854690.1 |
Coordinates | 4027056..4027433 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1P7N8 |
Locus tag | QJP97_RS19900 | Protein ID | WP_001305076.1 |
Coordinates | 4026599..4026967 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP97_RS19860 (4021681) | 4021681..4022808 | + | 1128 | Protein_3889 | hypothetical protein | - |
QJP97_RS19865 (4022884) | 4022884..4023339 | + | 456 | WP_000581502.1 | IrmA family protein | - |
QJP97_RS19870 (4023418) | 4023418..4023651 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
QJP97_RS19875 (4023752) | 4023752..4024570 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
QJP97_RS19880 (4024625) | 4024625..4025110 | + | 486 | WP_000849565.1 | antirestriction protein | - |
QJP97_RS19885 (4025126) | 4025126..4025602 | + | 477 | WP_001186726.1 | RadC family protein | - |
QJP97_RS19890 (4025665) | 4025665..4025886 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
QJP97_RS19895 (4025905) | 4025905..4026549 | + | 645 | WP_000094916.1 | hypothetical protein | - |
QJP97_RS19900 (4026599) | 4026599..4026967 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP97_RS19905 (4027056) | 4027056..4027433 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
QJP97_RS19910 (4027430) | 4027430..4027918 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
QJP97_RS19915 (4027935) | 4027935..4028132 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
QJP97_RS19920 (4028217) | 4028217..4029062 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
QJP97_RS19925 (4029131) | 4029131..4029526 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
QJP97_RS19930 (4029519) | 4029519..4030452 | + | 934 | Protein_3903 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
QJP97_RS19935 (4030869) | 4030869..4031039 | + | 171 | Protein_3904 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT / kpsM | 4002567..4046103 | 43536 | |
- | flank | IS/Tn | - | - | 4030884..4031039 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T279934 WP_000854690.1 NZ_CP124374:4027056-4027433 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT279934 WP_001305076.1 NZ_CP124374:4026599-4026967 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|