Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4026599..4027433 Replicon chromosome
Accession NZ_CP124374
Organism Escherichia coli strain AVS0578

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP97_RS19905 Protein ID WP_000854690.1
Coordinates 4027056..4027433 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP97_RS19900 Protein ID WP_001305076.1
Coordinates 4026599..4026967 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP97_RS19860 (4021681) 4021681..4022808 + 1128 Protein_3889 hypothetical protein -
QJP97_RS19865 (4022884) 4022884..4023339 + 456 WP_000581502.1 IrmA family protein -
QJP97_RS19870 (4023418) 4023418..4023651 + 234 WP_000902034.1 DUF905 family protein -
QJP97_RS19875 (4023752) 4023752..4024570 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJP97_RS19880 (4024625) 4024625..4025110 + 486 WP_000849565.1 antirestriction protein -
QJP97_RS19885 (4025126) 4025126..4025602 + 477 WP_001186726.1 RadC family protein -
QJP97_RS19890 (4025665) 4025665..4025886 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJP97_RS19895 (4025905) 4025905..4026549 + 645 WP_000094916.1 hypothetical protein -
QJP97_RS19900 (4026599) 4026599..4026967 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP97_RS19905 (4027056) 4027056..4027433 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP97_RS19910 (4027430) 4027430..4027918 + 489 WP_000761699.1 DUF5983 family protein -
QJP97_RS19915 (4027935) 4027935..4028132 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJP97_RS19920 (4028217) 4028217..4029062 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP97_RS19925 (4029131) 4029131..4029526 + 396 WP_000208384.1 DUF6088 family protein -
QJP97_RS19930 (4029519) 4029519..4030452 + 934 Protein_3903 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP97_RS19935 (4030869) 4030869..4031039 + 171 Protein_3904 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT / kpsM 4002567..4046103 43536
- flank IS/Tn - - 4030884..4031039 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T279934 WP_000854690.1 NZ_CP124374:4027056-4027433 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT279934 WP_001305076.1 NZ_CP124374:4026599-4026967 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References