Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2978952..2979783 Replicon chromosome
Accession NZ_CP124374
Organism Escherichia coli strain AVS0578

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP97_RS15075 Protein ID WP_000854815.1
Coordinates 2979409..2979783 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP97_RS15070 Protein ID WP_001280918.1
Coordinates 2978952..2979320 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP97_RS15025 (2974041) 2974041..2974787 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP97_RS15030 (2974870) 2974870..2975220 + 351 Protein_2945 hypothetical protein -
QJP97_RS15035 (2975236) 2975236..2975646 + 411 WP_000846703.1 hypothetical protein -
QJP97_RS15040 (2975867) 2975867..2976685 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJP97_RS15045 (2976685) 2976685..2976930 + 246 WP_001164966.1 hypothetical protein -
QJP97_RS15050 (2977024) 2977024..2977497 + 474 WP_001542276.1 antirestriction protein -
QJP97_RS15055 (2977513) 2977513..2977989 + 477 WP_001186200.1 RadC family protein -
QJP97_RS15060 (2978052) 2978052..2978273 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP97_RS15065 (2978292) 2978292..2978936 + 645 WP_000086752.1 hypothetical protein -
QJP97_RS15070 (2978952) 2978952..2979320 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP97_RS15075 (2979409) 2979409..2979783 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP97_RS15080 (2979780) 2979780..2979974 + 195 WP_000988600.1 DUF5983 family protein -
QJP97_RS15085 (2980020) 2980020..2980100 + 81 Protein_2956 hypothetical protein -
QJP97_RS15090 (2980389) 2980389..2980469 - 81 WP_023441679.1 hypothetical protein -
QJP97_RS15095 (2980448) 2980448..2980771 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP97_RS15100 (2980872) 2980872..2981201 - 330 WP_000450409.1 DUF496 family protein -
QJP97_RS15105 (2981373) 2981373..2982431 - 1059 WP_001200889.1 FUSC family protein -
QJP97_RS15110 (2982629) 2982629..2983102 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP97_RS15115 (2983221) 2983221..2984387 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279931 WP_000854815.1 NZ_CP124374:2979409-2979783 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279931 WP_001280918.1 NZ_CP124374:2978952-2979320 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References