Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2978952..2979783 | Replicon | chromosome |
| Accession | NZ_CP124374 | ||
| Organism | Escherichia coli strain AVS0578 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A066T988 |
| Locus tag | QJP97_RS15075 | Protein ID | WP_000854815.1 |
| Coordinates | 2979409..2979783 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
| Locus tag | QJP97_RS15070 | Protein ID | WP_001280918.1 |
| Coordinates | 2978952..2979320 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP97_RS15025 (2974041) | 2974041..2974787 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP97_RS15030 (2974870) | 2974870..2975220 | + | 351 | Protein_2945 | hypothetical protein | - |
| QJP97_RS15035 (2975236) | 2975236..2975646 | + | 411 | WP_000846703.1 | hypothetical protein | - |
| QJP97_RS15040 (2975867) | 2975867..2976685 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
| QJP97_RS15045 (2976685) | 2976685..2976930 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| QJP97_RS15050 (2977024) | 2977024..2977497 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| QJP97_RS15055 (2977513) | 2977513..2977989 | + | 477 | WP_001186200.1 | RadC family protein | - |
| QJP97_RS15060 (2978052) | 2978052..2978273 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP97_RS15065 (2978292) | 2978292..2978936 | + | 645 | WP_000086752.1 | hypothetical protein | - |
| QJP97_RS15070 (2978952) | 2978952..2979320 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP97_RS15075 (2979409) | 2979409..2979783 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QJP97_RS15080 (2979780) | 2979780..2979974 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| QJP97_RS15085 (2980020) | 2980020..2980100 | + | 81 | Protein_2956 | hypothetical protein | - |
| QJP97_RS15090 (2980389) | 2980389..2980469 | - | 81 | WP_023441679.1 | hypothetical protein | - |
| QJP97_RS15095 (2980448) | 2980448..2980771 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
| QJP97_RS15100 (2980872) | 2980872..2981201 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| QJP97_RS15105 (2981373) | 2981373..2982431 | - | 1059 | WP_001200889.1 | FUSC family protein | - |
| QJP97_RS15110 (2982629) | 2982629..2983102 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
| QJP97_RS15115 (2983221) | 2983221..2984387 | - | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T279931 WP_000854815.1 NZ_CP124374:2979409-2979783 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13811.70 Da Isoelectric Point: 6.4767
>AT279931 WP_001280918.1 NZ_CP124374:2978952-2979320 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066T988 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061Y7A8 |