Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1208761..1209379 | Replicon | chromosome |
Accession | NZ_CP124374 | ||
Organism | Escherichia coli strain AVS0578 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QJP97_RS05820 | Protein ID | WP_001291435.1 |
Coordinates | 1208761..1208979 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QJP97_RS05825 | Protein ID | WP_000344800.1 |
Coordinates | 1209005..1209379 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP97_RS05785 (1204048) | 1204048..1204620 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
QJP97_RS05790 (1204651) | 1204651..1204962 | - | 312 | WP_000409908.1 | MGMT family protein | - |
QJP97_RS05800 (1205341) | 1205341..1205694 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
QJP97_RS05805 (1205736) | 1205736..1207286 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QJP97_RS05810 (1207450) | 1207450..1207920 | - | 471 | WP_000136192.1 | YlaC family protein | - |
QJP97_RS05815 (1208036) | 1208036..1208587 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QJP97_RS05820 (1208761) | 1208761..1208979 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QJP97_RS05825 (1209005) | 1209005..1209379 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QJP97_RS05830 (1209925) | 1209925..1213074 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QJP97_RS05835 (1213097) | 1213097..1214290 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279920 WP_001291435.1 NZ_CP124374:c1208979-1208761 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279920 WP_000344800.1 NZ_CP124374:c1209379-1209005 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |