Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 757949..758469 Replicon chromosome
Accession NZ_CP124374
Organism Escherichia coli strain AVS0578

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP97_RS03670 Protein ID WP_001160964.1
Coordinates 758185..758469 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP97_RS03665 Protein ID WP_000125566.1
Coordinates 757949..758182 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP97_RS03640 (753022) 753022..753309 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJP97_RS03645 (753368) 753368..754699 + 1332 WP_001183209.1 MFS transporter -
QJP97_RS03650 (754807) 754807..755337 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP97_RS03655 (755330) 755330..757192 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP97_RS03660 (757384) 757384..757863 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP97_RS03665 (757949) 757949..758182 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP97_RS03670 (758185) 758185..758469 + 285 WP_001160964.1 CcdB family protein Toxin
QJP97_RS03675 (758496) 758496..759344 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP97_RS03680 (759351) 759351..759728 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP97_RS03685 (759731) 759731..760552 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP97_RS03690 (760549) 760549..761538 - 990 WP_094326588.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP97_RS03695 (761538) 761538..762824 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T279918 WP_001160964.1 NZ_CP124374:758185-758469 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279918 WP_000125566.1 NZ_CP124374:757949-758182 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References