Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 518956..519791 | Replicon | chromosome |
Accession | NZ_CP124374 | ||
Organism | Escherichia coli strain AVS0578 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | QJP97_RS02460 | Protein ID | WP_000854759.1 |
Coordinates | 519414..519791 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | QJP97_RS02455 | Protein ID | WP_001295723.1 |
Coordinates | 518956..519324 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP97_RS02430 (514958) | 514958..515431 | + | 474 | WP_001350782.1 | antirestriction protein | - |
QJP97_RS02435 (515447) | 515447..515923 | + | 477 | WP_001186774.1 | RadC family protein | - |
QJP97_RS02440 (515986) | 515986..516240 | + | 255 | WP_023281719.1 | DUF987 domain-containing protein | - |
QJP97_RS02445 (516381) | 516381..517922 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
QJP97_RS02450 (517937) | 517937..518683 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
QJP97_RS02455 (518956) | 518956..519324 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJP97_RS02460 (519414) | 519414..519791 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
QJP97_RS02465 (519788) | 519788..520276 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
QJP97_RS02470 (520293) | 520293..520469 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
QJP97_RS02475 (520575) | 520575..520724 | + | 150 | Protein_476 | hypothetical protein | - |
QJP97_RS02480 (521091) | 521091..521267 | + | 177 | Protein_477 | helix-turn-helix domain-containing protein | - |
QJP97_RS02485 (522058) | 522058..523680 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279916 WP_000854759.1 NZ_CP124374:519414-519791 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |