Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 140119..140762 | Replicon | plasmid pAVS0151-A |
| Accession | NZ_CP124373 | ||
| Organism | Escherichia coli strain AVS0151 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QJP92_RS27080 | Protein ID | WP_001034044.1 |
| Coordinates | 140346..140762 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QJP92_RS27075 | Protein ID | WP_001261286.1 |
| Coordinates | 140119..140349 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP92_RS27055 (136750) | 136750..137505 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP92_RS27060 (138227) | 138227..139033 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| QJP92_RS27065 (139034) | 139034..139339 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| QJP92_RS27070 (139341) | 139341..139559 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| QJP92_RS27075 (140119) | 140119..140349 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJP92_RS27080 (140346) | 140346..140762 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJP92_RS27085 (140837) | 140837..142402 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QJP92_RS27090 (142387) | 142387..143409 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| QJP92_RS27095 (143663) | 143663..144349 | - | 687 | Protein_177 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / tet(A) | senB / iutA / iutA / iucD | 1..150420 | 150420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T279913 WP_001034044.1 NZ_CP124373:140346-140762 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |