Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 139034..139559 Replicon plasmid pAVS0151-A
Accession NZ_CP124373
Organism Escherichia coli strain AVS0151

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QJP92_RS27065 Protein ID WP_001159871.1
Coordinates 139034..139339 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QJP92_RS27070 Protein ID WP_000813630.1
Coordinates 139341..139559 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP92_RS27050 (134996) 134996..136162 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
QJP92_RS27055 (136750) 136750..137505 - 756 WP_000852146.1 replication initiation protein RepE -
QJP92_RS27060 (138227) 138227..139033 - 807 WP_000016970.1 site-specific integrase -
QJP92_RS27065 (139034) 139034..139339 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QJP92_RS27070 (139341) 139341..139559 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QJP92_RS27075 (140119) 140119..140349 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QJP92_RS27080 (140346) 140346..140762 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QJP92_RS27085 (140837) 140837..142402 + 1566 WP_001128474.1 AAA family ATPase -
QJP92_RS27090 (142387) 142387..143409 + 1023 WP_000361402.1 helicase UvrD -
QJP92_RS27095 (143663) 143663..144349 - 687 Protein_177 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / tet(A) senB / iutA / iutA / iucD 1..150420 150420


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T279912 WP_001159871.1 NZ_CP124373:c139339-139034 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT279912 WP_000813630.1 NZ_CP124373:c139559-139341 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References