Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 139034..139559 | Replicon | plasmid pAVS0151-A |
Accession | NZ_CP124373 | ||
Organism | Escherichia coli strain AVS0151 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | QJP92_RS27065 | Protein ID | WP_001159871.1 |
Coordinates | 139034..139339 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | QJP92_RS27070 | Protein ID | WP_000813630.1 |
Coordinates | 139341..139559 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP92_RS27050 (134996) | 134996..136162 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QJP92_RS27055 (136750) | 136750..137505 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP92_RS27060 (138227) | 138227..139033 | - | 807 | WP_000016970.1 | site-specific integrase | - |
QJP92_RS27065 (139034) | 139034..139339 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QJP92_RS27070 (139341) | 139341..139559 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QJP92_RS27075 (140119) | 140119..140349 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QJP92_RS27080 (140346) | 140346..140762 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
QJP92_RS27085 (140837) | 140837..142402 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
QJP92_RS27090 (142387) | 142387..143409 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
QJP92_RS27095 (143663) | 143663..144349 | - | 687 | Protein_177 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / tet(A) | senB / iutA / iutA / iucD | 1..150420 | 150420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T279912 WP_001159871.1 NZ_CP124373:c139339-139034 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |