Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 5241265..5242096 Replicon chromosome
Accession NZ_CP124372
Organism Escherichia coli strain AVS0151

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP92_RS26055 Protein ID WP_000854815.1
Coordinates 5241722..5242096 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP92_RS26050 Protein ID WP_001280918.1
Coordinates 5241265..5241633 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP92_RS26020 (5236780) 5236780..5237484 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
QJP92_RS26025 (5237538) 5237538..5237978 - 441 Protein_5093 CatB-related O-acetyltransferase -
QJP92_RS26030 (5238116) 5238116..5238946 - 831 WP_001334766.1 oxacillin-hydrolyzing class D beta-lactamase OXA-1 -
QJP92_RS26035 (5239077) 5239077..5239631 - 555 WP_063840321.1 fluoroquinolone-acetylating aminoglycoside 6'-N-acetyltransferase AAC(6')-Ib-cr5 -
QJP92_RS26040 (5239775) 5239775..5240479 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
QJP92_RS26045 (5240605) 5240605..5241249 + 645 WP_000086752.1 hypothetical protein -
QJP92_RS26050 (5241265) 5241265..5241633 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP92_RS26055 (5241722) 5241722..5242096 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP92_RS26060 (5242093) 5242093..5242287 + 195 WP_000988600.1 DUF5983 family protein -
QJP92_RS26065 (5242333) 5242333..5242413 + 81 Protein_5101 hypothetical protein -
QJP92_RS26070 (5242702) 5242702..5242782 - 81 WP_023441679.1 hypothetical protein -
QJP92_RS26075 (5242761) 5242761..5243084 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP92_RS26080 (5243185) 5243185..5243514 - 330 WP_000450409.1 DUF496 family protein -
QJP92_RS26085 (5243686) 5243686..5244744 - 1059 WP_001200889.1 FUSC family protein -
QJP92_RS26090 (5244942) 5244942..5245415 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP92_RS26095 (5245534) 5245534..5246700 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr - 5227739..5247539 19800
- flank IS/Tn - - 5246835..5247539 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279904 WP_000854815.1 NZ_CP124372:5241722-5242096 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279904 WP_001280918.1 NZ_CP124372:5241265-5241633 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References