Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4233365..4234199 Replicon chromosome
Accession NZ_CP124372
Organism Escherichia coli strain AVS0151

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJP92_RS21265 Protein ID WP_000854690.1
Coordinates 4233365..4233742 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJP92_RS21270 Protein ID WP_001305076.1
Coordinates 4233831..4234199 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP92_RS21235 (4229759) 4229759..4229929 - 171 Protein_4157 IS110 family transposase -
QJP92_RS21240 (4230346) 4230346..4231279 - 934 Protein_4158 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJP92_RS21245 (4231272) 4231272..4231667 - 396 WP_000208384.1 DUF6088 family protein -
QJP92_RS21250 (4231736) 4231736..4232581 - 846 WP_001529401.1 DUF4942 domain-containing protein -
QJP92_RS21255 (4232666) 4232666..4232863 - 198 WP_000839293.1 DUF957 domain-containing protein -
QJP92_RS21260 (4232880) 4232880..4233368 - 489 WP_000761699.1 DUF5983 family protein -
QJP92_RS21265 (4233365) 4233365..4233742 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJP92_RS21270 (4233831) 4233831..4234199 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP92_RS21275 (4234249) 4234249..4234893 - 645 WP_000094916.1 hypothetical protein -
QJP92_RS21280 (4234912) 4234912..4235133 - 222 WP_000692329.1 DUF987 domain-containing protein -
QJP92_RS21285 (4235196) 4235196..4235672 - 477 WP_001186726.1 RadC family protein -
QJP92_RS21290 (4235688) 4235688..4236173 - 486 WP_000849565.1 antirestriction protein -
QJP92_RS21295 (4236228) 4236228..4237046 - 819 WP_001234620.1 DUF932 domain-containing protein -
QJP92_RS21300 (4237147) 4237147..4237380 - 234 WP_000902034.1 DUF905 family protein -
QJP92_RS21305 (4237459) 4237459..4237914 - 456 WP_000581502.1 IrmA family protein -
QJP92_RS21310 (4237990) 4237990..4239117 - 1128 Protein_4172 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 4211748..4236173 24425
- flank IS/Tn - - 4229759..4229914 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T279902 WP_000854690.1 NZ_CP124372:c4233742-4233365 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT279902 WP_001305076.1 NZ_CP124372:c4234199-4233831 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References