Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 3715106..3715906 | Replicon | chromosome |
Accession | NZ_CP124372 | ||
Organism | Escherichia coli strain AVS0151 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | QJP92_RS18670 | Protein ID | WP_000342452.1 |
Coordinates | 3715379..3715906 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | QJP92_RS18665 | Protein ID | WP_001277107.1 |
Coordinates | 3715106..3715372 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP92_RS18645 (3710765) | 3710765..3711433 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
QJP92_RS18650 (3711426) | 3711426..3712484 | + | 1059 | WP_001042013.1 | permease-like cell division protein FtsX | - |
QJP92_RS18655 (3712729) | 3712729..3713583 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QJP92_RS18660 (3713854) | 3713854..3714957 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QJP92_RS18665 (3715106) | 3715106..3715372 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QJP92_RS18670 (3715379) | 3715379..3715906 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QJP92_RS18675 (3715903) | 3715903..3716286 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QJP92_RS18680 (3716709) | 3716709..3717818 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QJP92_RS18685 (3717866) | 3717866..3718792 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QJP92_RS18690 (3718789) | 3718789..3720066 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
QJP92_RS18695 (3720063) | 3720063..3720830 | + | 768 | WP_000082099.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T279899 WP_000342452.1 NZ_CP124372:3715379-3715906 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |