Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2811138..2811939 | Replicon | chromosome |
| Accession | NZ_CP124372 | ||
| Organism | Escherichia coli strain AVS0151 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | QJP92_RS14345 | Protein ID | WP_001094436.1 |
| Coordinates | 2811562..2811939 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | QJP92_RS14340 | Protein ID | WP_015953067.1 |
| Coordinates | 2811138..2811515 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP92_RS14305 (2807049) | 2807049..2807729 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP92_RS14310 (2807877) | 2807877..2808554 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP92_RS14315 (2808560) | 2808560..2808793 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| QJP92_RS14320 (2808883) | 2808883..2809701 | + | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
| QJP92_RS14325 (2809793) | 2809793..2810278 | + | 486 | WP_029700724.1 | antirestriction protein | - |
| QJP92_RS14330 (2810293) | 2810293..2810769 | + | 477 | WP_001186756.1 | RadC family protein | - |
| QJP92_RS14335 (2810838) | 2810838..2811059 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP92_RS14340 (2811138) | 2811138..2811515 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP92_RS14345 (2811562) | 2811562..2811939 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| QJP92_RS14350 (2811936) | 2811936..2812424 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QJP92_RS14355 (2812436) | 2812436..2812633 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| QJP92_RS14360 (2812718) | 2812718..2813428 | + | 711 | WP_001621817.1 | DUF4942 domain-containing protein | - |
| QJP92_RS14365 (2813477) | 2813477..2814232 | - | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| QJP92_RS14370 (2814229) | 2814229..2815728 | - | 1500 | WP_029700729.1 | IS21-like element ISEc10 family transposase | - |
| QJP92_RS14375 (2815819) | 2815819..2815980 | + | 162 | Protein_2825 | DUF4942 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T279896 WP_001094436.1 NZ_CP124372:2811562-2811939 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT279896 WP_015953067.1 NZ_CP124372:2811138-2811515 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |