Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2811138..2811939 Replicon chromosome
Accession NZ_CP124372
Organism Escherichia coli strain AVS0151

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QJP92_RS14345 Protein ID WP_001094436.1
Coordinates 2811562..2811939 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QJP92_RS14340 Protein ID WP_015953067.1
Coordinates 2811138..2811515 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP92_RS14305 (2807049) 2807049..2807729 + 681 WP_001282919.1 WYL domain-containing protein -
QJP92_RS14310 (2807877) 2807877..2808554 + 678 WP_001097301.1 hypothetical protein -
QJP92_RS14315 (2808560) 2808560..2808793 + 234 WP_001278287.1 DUF905 family protein -
QJP92_RS14320 (2808883) 2808883..2809701 + 819 WP_001175163.1 DUF932 domain-containing protein -
QJP92_RS14325 (2809793) 2809793..2810278 + 486 WP_029700724.1 antirestriction protein -
QJP92_RS14330 (2810293) 2810293..2810769 + 477 WP_001186756.1 RadC family protein -
QJP92_RS14335 (2810838) 2810838..2811059 + 222 WP_000692312.1 DUF987 domain-containing protein -
QJP92_RS14340 (2811138) 2811138..2811515 + 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP92_RS14345 (2811562) 2811562..2811939 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QJP92_RS14350 (2811936) 2811936..2812424 + 489 WP_000761714.1 DUF5983 family protein -
QJP92_RS14355 (2812436) 2812436..2812633 + 198 WP_000839254.1 DUF957 domain-containing protein -
QJP92_RS14360 (2812718) 2812718..2813428 + 711 WP_001621817.1 DUF4942 domain-containing protein -
QJP92_RS14365 (2813477) 2813477..2814232 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
QJP92_RS14370 (2814229) 2814229..2815728 - 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
QJP92_RS14375 (2815819) 2815819..2815980 + 162 Protein_2825 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T279896 WP_001094436.1 NZ_CP124372:2811562-2811939 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT279896 WP_015953067.1 NZ_CP124372:2811138-2811515 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References