Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2509858..2510693 | Replicon | chromosome |
| Accession | NZ_CP124372 | ||
| Organism | Escherichia coli strain AVS0151 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP92_RS12815 | Protein ID | WP_000854759.1 |
| Coordinates | 2509858..2510235 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP92_RS12820 | Protein ID | WP_001295723.1 |
| Coordinates | 2510325..2510693 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP92_RS12785 (2505796) | 2505796..2505972 | - | 177 | Protein_2512 | helix-turn-helix domain-containing protein | - |
| QJP92_RS12790 (2506164) | 2506164..2506910 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP92_RS12795 (2506925) | 2506925..2508466 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP92_RS12800 (2508925) | 2508925..2509074 | - | 150 | Protein_2515 | hypothetical protein | - |
| QJP92_RS12805 (2509180) | 2509180..2509356 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP92_RS12810 (2509373) | 2509373..2509861 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP92_RS12815 (2509858) | 2509858..2510235 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP92_RS12820 (2510325) | 2510325..2510693 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP92_RS12825 (2510856) | 2510856..2511077 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJP92_RS12830 (2511140) | 2511140..2511616 | - | 477 | WP_001186775.1 | RadC family protein | - |
| QJP92_RS12835 (2511632) | 2511632..2512105 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP92_RS12840 (2512447) | 2512447..2513265 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJP92_RS12845 (2513383) | 2513383..2513578 | - | 196 | Protein_2524 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279894 WP_000854759.1 NZ_CP124372:c2510235-2509858 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT279894 WP_001295723.1 NZ_CP124372:c2510693-2510325 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |