Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2316476..2316996 Replicon chromosome
Accession NZ_CP124372
Organism Escherichia coli strain AVS0151

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJP92_RS11880 Protein ID WP_001160964.1
Coordinates 2316476..2316760 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP92_RS11885 Protein ID WP_000125566.1
Coordinates 2316763..2316996 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP92_RS11855 (2312121) 2312121..2313407 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP92_RS11860 (2313407) 2313407..2314396 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP92_RS11865 (2314393) 2314393..2315214 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP92_RS11870 (2315217) 2315217..2315594 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP92_RS11875 (2315601) 2315601..2316449 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP92_RS11880 (2316476) 2316476..2316760 - 285 WP_001160964.1 CcdB family protein Toxin
QJP92_RS11885 (2316763) 2316763..2316996 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP92_RS11890 (2317082) 2317082..2317561 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP92_RS11895 (2317753) 2317753..2319615 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJP92_RS11900 (2319608) 2319608..2320138 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP92_RS11905 (2320246) 2320246..2321577 - 1332 WP_001183209.1 MFS transporter -
QJP92_RS11910 (2321636) 2321636..2321923 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T279892 WP_001160964.1 NZ_CP124372:c2316760-2316476 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279892 WP_000125566.1 NZ_CP124372:c2316996-2316763 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References