Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1864800..1865418 | Replicon | chromosome |
| Accession | NZ_CP124372 | ||
| Organism | Escherichia coli strain AVS0151 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP92_RS09725 | Protein ID | WP_001291435.1 |
| Coordinates | 1865200..1865418 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP92_RS09720 | Protein ID | WP_000344800.1 |
| Coordinates | 1864800..1865174 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP92_RS09710 (1859889) | 1859889..1861082 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QJP92_RS09715 (1861105) | 1861105..1864254 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP92_RS09720 (1864800) | 1864800..1865174 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP92_RS09725 (1865200) | 1865200..1865418 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP92_RS09730 (1865592) | 1865592..1866143 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP92_RS09735 (1866259) | 1866259..1866729 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP92_RS09740 (1866893) | 1866893..1868443 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP92_RS09745 (1868485) | 1868485..1868838 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| QJP92_RS09755 (1869217) | 1869217..1869528 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP92_RS09760 (1869559) | 1869559..1870131 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279890 WP_001291435.1 NZ_CP124372:1865200-1865418 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279890 WP_000344800.1 NZ_CP124372:1864800-1865174 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |