Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 86960..87519 Replicon plasmid pAVS0465-A
Accession NZ_CP124368
Organism Escherichia coli strain AVS0465

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag QJP75_RS25935 Protein ID WP_000421272.1
Coordinates 86960..87235 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag QJP75_RS25940 Protein ID WP_001387467.1
Coordinates 87235..87519 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP75_RS25900 (82134) 82134..83156 + 1023 WP_000361402.1 helicase UvrD -
QJP75_RS25910 (84141) 84141..84409 - 269 Protein_99 type II toxin-antitoxin system RelE/ParE family toxin -
QJP75_RS25915 (84396) 84396..84664 - 269 Protein_100 type II toxin-antitoxin system ParD family antitoxin -
QJP75_RS25920 (85196) 85196..86365 + 1170 WP_001072355.1 hypothetical protein -
QJP75_RS25925 (86398) 86398..86526 + 129 Protein_102 IS481 family transposase -
QJP75_RS25930 (86651) 86651..86854 - 204 Protein_103 hypothetical protein -
QJP75_RS25935 (86960) 86960..87235 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QJP75_RS25940 (87235) 87235..87519 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
QJP75_RS25945 (88124) 88124..88876 + 753 WP_000562172.1 IclR family transcriptional regulator -
QJP75_RS25950 (88922) 88922..89887 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
QJP75_RS25955 (89920) 89920..90300 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
QJP75_RS25960 (90325) 90325..91215 - 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
QJP75_RS25965 (91448) 91448..91642 - 195 WP_000796505.1 hypothetical protein -
QJP75_RS25970 (91616) 91616..92056 + 441 Protein_111 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qacE / sul1 / mph(A) / dfrA17 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..103076 103076
- flank IS/Tn - - 83410..83913 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T279882 WP_000421272.1 NZ_CP124368:c87235-86960 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT279882 WP_001387467.1 NZ_CP124368:c87519-87235 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References