Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 79866..80509 | Replicon | plasmid pAVS0465-A |
Accession | NZ_CP124368 | ||
Organism | Escherichia coli strain AVS0465 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | QJP75_RS25890 | Protein ID | WP_001034044.1 |
Coordinates | 80093..80509 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | QJP75_RS25885 | Protein ID | WP_001261286.1 |
Coordinates | 79866..80096 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP75_RS25870 (75003) | 75003..75233 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QJP75_RS25875 (75230) | 75230..75646 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
QJP75_RS25880 (75691) | 75691..79485 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
QJP75_RS25885 (79866) | 79866..80096 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QJP75_RS25890 (80093) | 80093..80509 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QJP75_RS25895 (80584) | 80584..82149 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
QJP75_RS25900 (82134) | 82134..83156 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
QJP75_RS25910 (84141) | 84141..84409 | - | 269 | Protein_99 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QJP75_RS25915 (84396) | 84396..84664 | - | 269 | Protein_100 | type II toxin-antitoxin system ParD family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | qacE / sul1 / mph(A) / dfrA17 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..103076 | 103076 | |
- | flank | IS/Tn | - | - | 83410..83913 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T279881 WP_001034044.1 NZ_CP124368:80093-80509 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |