Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 67995..68520 | Replicon | plasmid pAVS0465-A |
| Accession | NZ_CP124368 | ||
| Organism | Escherichia coli strain AVS0465 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QJP75_RS25825 | Protein ID | WP_001159868.1 |
| Coordinates | 67995..68300 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QJP75_RS25830 | Protein ID | WP_000813634.1 |
| Coordinates | 68302..68520 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP75_RS25810 (63905) | 63905..65071 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QJP75_RS25815 (65659) | 65659..66414 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP75_RS25820 (67188) | 67188..67994 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| QJP75_RS25825 (67995) | 67995..68300 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJP75_RS25830 (68302) | 68302..68520 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJP75_RS25835 (69066) | 69066..69578 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| QJP75_RS25840 (69612) | 69612..70733 | - | 1122 | WP_012783980.1 | DUF3800 domain-containing protein | - |
| QJP75_RS25845 (70825) | 70825..71250 | + | 426 | WP_000422741.1 | transposase | - |
| QJP75_RS25850 (71247) | 71247..71597 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP75_RS25855 (71628) | 71628..73241 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | qacE / sul1 / mph(A) / dfrA17 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..103076 | 103076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T279879 WP_001159868.1 NZ_CP124368:c68300-67995 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|