Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3580006..3580841 | Replicon | chromosome |
| Accession | NZ_CP124367 | ||
| Organism | Escherichia coli strain AVS0465 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJP75_RS17375 | Protein ID | WP_000854759.1 |
| Coordinates | 3580464..3580841 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJP75_RS17370 | Protein ID | WP_001295723.1 |
| Coordinates | 3580006..3580374 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP75_RS17345 (3576008) | 3576008..3576481 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJP75_RS17350 (3576497) | 3576497..3576973 | + | 477 | WP_001186774.1 | RadC family protein | - |
| QJP75_RS17355 (3577036) | 3577036..3577290 | + | 255 | WP_023281719.1 | DUF987 domain-containing protein | - |
| QJP75_RS17360 (3577431) | 3577431..3578972 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJP75_RS17365 (3578987) | 3578987..3579733 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJP75_RS17370 (3580006) | 3580006..3580374 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP75_RS17375 (3580464) | 3580464..3580841 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJP75_RS17380 (3580838) | 3580838..3581326 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJP75_RS17385 (3581343) | 3581343..3581519 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJP75_RS17390 (3581625) | 3581625..3581774 | + | 150 | Protein_3397 | hypothetical protein | - |
| QJP75_RS17395 (3582141) | 3582141..3582317 | + | 177 | Protein_3398 | helix-turn-helix domain-containing protein | - |
| QJP75_RS17400 (3583108) | 3583108..3584730 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279866 WP_000854759.1 NZ_CP124367:3580464-3580841 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT279866 WP_001295723.1 NZ_CP124367:3580006-3580374 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |