Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3480607..3481202 | Replicon | chromosome |
Accession | NZ_CP124367 | ||
Organism | Escherichia coli strain AVS0465 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QJP75_RS16870 | Protein ID | WP_000239579.1 |
Coordinates | 3480852..3481202 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QJP75_RS16865 | Protein ID | WP_001223208.1 |
Coordinates | 3480607..3480858 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP75_RS16855 (3476272) | 3476272..3480051 | + | 3780 | WP_000060945.1 | autotransporter assembly complex protein TamB | - |
QJP75_RS16860 (3480054) | 3480054..3480395 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QJP75_RS16865 (3480607) | 3480607..3480858 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QJP75_RS16870 (3480852) | 3480852..3481202 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QJP75_RS16875 (3481282) | 3481282..3481812 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QJP75_RS16880 (3482122) | 3482122..3483078 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QJP75_RS16885 (3483218) | 3483218..3484720 | + | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
QJP75_RS16890 (3484734) | 3484734..3485756 | + | 1023 | WP_001296689.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T279865 WP_000239579.1 NZ_CP124367:3480852-3481202 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |