Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3325212..3326044 | Replicon | chromosome |
| Accession | NZ_CP124367 | ||
| Organism | Escherichia coli strain AVS0465 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | QJP75_RS16035 | Protein ID | WP_000854753.1 |
| Coordinates | 3325212..3325586 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | QJP75_RS16040 | Protein ID | WP_001540478.1 |
| Coordinates | 3325676..3326044 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP75_RS16010 (3321565) | 3321565..3323103 | - | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QJP75_RS16015 (3323363) | 3323363..3323522 | - | 160 | Protein_3127 | integrase | - |
| QJP75_RS16020 (3323852) | 3323852..3324421 | - | 570 | WP_001560692.1 | DUF4942 domain-containing protein | - |
| QJP75_RS16025 (3324518) | 3324518..3324715 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| QJP75_RS16030 (3324727) | 3324727..3325215 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
| QJP75_RS16035 (3325212) | 3325212..3325586 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| QJP75_RS16040 (3325676) | 3325676..3326044 | - | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP75_RS16045 (3326207) | 3326207..3326428 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| QJP75_RS16050 (3326491) | 3326491..3326967 | - | 477 | WP_001313574.1 | RadC family protein | - |
| QJP75_RS16055 (3326983) | 3326983..3327468 | - | 486 | WP_000214398.1 | antirestriction protein | - |
| QJP75_RS16060 (3327559) | 3327559..3328377 | - | 819 | WP_001234682.1 | DUF932 domain-containing protein | - |
| QJP75_RS16065 (3328467) | 3328467..3328700 | - | 234 | WP_001278283.1 | DUF905 family protein | - |
| QJP75_RS16070 (3328706) | 3328706..3329383 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP75_RS16075 (3329531) | 3329531..3330211 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | papX | 3298161..3386662 | 88501 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T279864 WP_000854753.1 NZ_CP124367:c3325586-3325212 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT279864 WP_001540478.1 NZ_CP124367:c3326044-3325676 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |