Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2741255..2742090 | Replicon | chromosome |
| Accession | NZ_CP124367 | ||
| Organism | Escherichia coli strain AVS0465 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A376WVB1 |
| Locus tag | QJP75_RS13340 | Protein ID | WP_001094448.1 |
| Coordinates | 2741713..2742090 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3T7EC32 |
| Locus tag | QJP75_RS13335 | Protein ID | WP_024175935.1 |
| Coordinates | 2741255..2741623 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP75_RS13305 (2736463) | 2736463..2738613 | + | 2151 | Protein_2612 | Ag43/Cah family autotransporter adhesin | - |
| QJP75_RS13310 (2738684) | 2738684..2738917 | + | 234 | WP_001117568.1 | DUF905 family protein | - |
| QJP75_RS13315 (2739008) | 2739008..2739826 | + | 819 | WP_001234753.1 | DUF932 domain-containing protein | - |
| QJP75_RS13320 (2739918) | 2739918..2740403 | + | 486 | WP_000214415.1 | antirestriction protein | - |
| QJP75_RS13325 (2740415) | 2740415..2740891 | + | 477 | WP_001186709.1 | RadC family protein | - |
| QJP75_RS13330 (2740960) | 2740960..2741181 | + | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| QJP75_RS13335 (2741255) | 2741255..2741623 | + | 369 | WP_024175935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP75_RS13340 (2741713) | 2741713..2742090 | + | 378 | WP_001094448.1 | TA system toxin CbtA family protein | Toxin |
| QJP75_RS13345 (2742087) | 2742087..2742575 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QJP75_RS13350 (2742587) | 2742587..2742779 | + | 193 | Protein_2621 | hypothetical protein | - |
| QJP75_RS13355 (2742864) | 2742864..2743709 | + | 846 | WP_000065751.1 | DUF4942 domain-containing protein | - |
| QJP75_RS13360 (2744302) | 2744302..2744799 | + | 498 | WP_000509815.1 | hypothetical protein | - |
| QJP75_RS13365 (2744977) | 2744977..2745900 | + | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| QJP75_RS13370 (2745904) | 2745904..2746722 | - | 819 | WP_000779409.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14221.22 Da Isoelectric Point: 8.2919
>T279861 WP_001094448.1 NZ_CP124367:2741713-2742090 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13598.40 Da Isoelectric Point: 6.6255
>AT279861 WP_024175935.1 NZ_CP124367:2741255-2741623 [Escherichia coli]
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A376WVB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T7EC32 |