Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1898337..1899171 | Replicon | chromosome |
| Accession | NZ_CP124367 | ||
| Organism | Escherichia coli strain AVS0465 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E0IX31 |
| Locus tag | QJP75_RS09280 | Protein ID | WP_000854689.1 |
| Coordinates | 1898794..1899171 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1X3JHN3 |
| Locus tag | QJP75_RS09275 | Protein ID | WP_001285598.1 |
| Coordinates | 1898337..1898717 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP75_RS09240 (1894620) | 1894620..1895075 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QJP75_RS09245 (1895180) | 1895180..1895389 | + | 210 | WP_032142237.1 | DUF905 family protein | - |
| QJP75_RS09250 (1895490) | 1895490..1896308 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QJP75_RS09255 (1896363) | 1896363..1896848 | + | 486 | WP_282504306.1 | antirestriction protein | - |
| QJP75_RS09260 (1896864) | 1896864..1897340 | + | 477 | WP_001186727.1 | RadC family protein | - |
| QJP75_RS09265 (1897403) | 1897403..1897624 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QJP75_RS09270 (1897643) | 1897643..1898287 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QJP75_RS09275 (1898337) | 1898337..1898717 | + | 381 | WP_001285598.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJP75_RS09280 (1898794) | 1898794..1899171 | + | 378 | WP_000854689.1 | TA system toxin CbtA family protein | Toxin |
| QJP75_RS09285 (1899168) | 1899168..1899656 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| QJP75_RS09290 (1899673) | 1899673..1899870 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QJP75_RS09295 (1899955) | 1899955..1900800 | + | 846 | WP_023281696.1 | DUF4942 domain-containing protein | - |
| QJP75_RS09300 (1900869) | 1900869..1901264 | + | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QJP75_RS09305 (1901257) | 1901257..1902150 | + | 894 | WP_001114681.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QJP75_RS09310 (1902621) | 1902621..1902791 | + | 171 | Protein_1826 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14042.07 Da Isoelectric Point: 9.1510
>T279856 WP_000854689.1 NZ_CP124367:1898794-1899171 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13927.72 Da Isoelectric Point: 4.7959
>AT279856 WP_001285598.1 NZ_CP124367:1898337-1898717 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|