Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 818009..818840 Replicon chromosome
Accession NZ_CP124367
Organism Escherichia coli strain AVS0465

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJP75_RS04285 Protein ID WP_000854815.1
Coordinates 818466..818840 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJP75_RS04280 Protein ID WP_001280918.1
Coordinates 818009..818377 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP75_RS04235 (813098) 813098..813844 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP75_RS04240 (813927) 813927..814277 + 351 Protein_834 hypothetical protein -
QJP75_RS04245 (814293) 814293..814703 + 411 WP_000846703.1 hypothetical protein -
QJP75_RS04250 (814924) 814924..815742 + 819 WP_061091820.1 DUF932 domain-containing protein -
QJP75_RS04255 (815742) 815742..815987 + 246 WP_001164966.1 hypothetical protein -
QJP75_RS04260 (816081) 816081..816554 + 474 WP_000855069.1 antirestriction protein -
QJP75_RS04265 (816570) 816570..817046 + 477 WP_001186200.1 RadC family protein -
QJP75_RS04270 (817109) 817109..817330 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJP75_RS04275 (817349) 817349..817993 + 645 WP_000086752.1 hypothetical protein -
QJP75_RS04280 (818009) 818009..818377 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJP75_RS04285 (818466) 818466..818840 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP75_RS04290 (818837) 818837..819031 + 195 WP_000988600.1 DUF5983 family protein -
QJP75_RS04295 (819077) 819077..819157 + 81 Protein_845 hypothetical protein -
QJP75_RS04300 (819446) 819446..819526 - 81 WP_023441679.1 hypothetical protein -
QJP75_RS04305 (819505) 819505..819828 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJP75_RS04310 (819929) 819929..820258 - 330 WP_000450409.1 DUF496 family protein -
QJP75_RS04315 (820430) 820430..821488 - 1059 WP_001200889.1 FUSC family protein -
QJP75_RS04320 (821686) 821686..822159 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJP75_RS04325 (822278) 822278..823444 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279853 WP_000854815.1 NZ_CP124367:818466-818840 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279853 WP_001280918.1 NZ_CP124367:818009-818377 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References