Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4536806..4537641 | Replicon | chromosome |
Accession | NZ_CP124359 | ||
Organism | Escherichia coli strain AVS0093 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | Q8VR61 |
Locus tag | QJP83_RS22165 | Protein ID | WP_000854747.1 |
Coordinates | 4537264..4537641 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
Locus tag | QJP83_RS22160 | Protein ID | WP_024186867.1 |
Coordinates | 4536806..4537174 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP83_RS22125 (4532718) | 4532718..4533398 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
QJP83_RS22130 (4533546) | 4533546..4534223 | + | 678 | WP_001097301.1 | hypothetical protein | - |
QJP83_RS22135 (4534229) | 4534229..4534462 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
QJP83_RS22140 (4534552) | 4534552..4535370 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
QJP83_RS22145 (4535461) | 4535461..4535946 | + | 486 | WP_001588934.1 | antirestriction protein | - |
QJP83_RS22150 (4535961) | 4535961..4536437 | + | 477 | WP_001588933.1 | RadC family protein | - |
QJP83_RS22155 (4536506) | 4536506..4536727 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
QJP83_RS22160 (4536806) | 4536806..4537174 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
QJP83_RS22165 (4537264) | 4537264..4537641 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
QJP83_RS22170 (4537638) | 4537638..4538126 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
QJP83_RS22175 (4538138) | 4538138..4538335 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
QJP83_RS22180 (4538420) | 4538420..4539274 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
QJP83_RS22185 (4539592) | 4539592..4539751 | + | 160 | Protein_4353 | integrase | - |
QJP83_RS22190 (4540011) | 4540011..4541549 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4524122..4565045 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T279847 WP_000854747.1 NZ_CP124359:4537264-4537641 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT279847 WP_024186867.1 NZ_CP124359:4536806-4537174 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A0PK89 |