Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4044669..4045219 Replicon chromosome
Accession NZ_CP124359
Organism Escherichia coli strain AVS0093

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP83_RS19755 Protein ID WP_001160966.1
Coordinates 4044669..4044983 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP83_RS19760 Protein ID WP_000125566.1
Coordinates 4044986..4045219 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP83_RS19730 (4040344) 4040344..4041630 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP83_RS19735 (4041630) 4041630..4042619 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP83_RS19740 (4042616) 4042616..4043437 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP83_RS19745 (4043440) 4043440..4043817 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP83_RS19750 (4043824) 4043824..4044672 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP83_RS19755 (4044669) 4044669..4044983 - 315 WP_001160966.1 CcdB family protein Toxin
QJP83_RS19760 (4044986) 4044986..4045219 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP83_RS19765 (4045305) 4045305..4045784 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP83_RS19770 (4045976) 4045976..4047838 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP83_RS19775 (4047831) 4047831..4048361 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP83_RS19780 (4048469) 4048469..4049800 - 1332 WP_001183207.1 MFS transporter -
QJP83_RS19785 (4049859) 4049859..4050146 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279844 WP_001160966.1 NZ_CP124359:c4044983-4044669 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279844 WP_000125566.1 NZ_CP124359:c4045219-4044986 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References