Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2023546..2024377 Replicon chromosome
Accession NZ_CP124359
Organism Escherichia coli strain AVS0093

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP83_RS09670 Protein ID WP_000854814.1
Coordinates 2023546..2023920 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP83_RS09675 Protein ID WP_001546021.1
Coordinates 2024009..2024377 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP83_RS09635 (2019541) 2019541..2019870 + 330 WP_000450409.1 DUF496 family protein -
QJP83_RS09640 (2019971) 2019971..2020294 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP83_RS09645 (2020273) 2020273..2020353 + 81 WP_023441679.1 hypothetical protein -
QJP83_RS09650 (2020564) 2020564..2022105 + 1542 Protein_1894 IS21-like element ISEc12 family transposase -
QJP83_RS09655 (2022120) 2022120..2022866 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP83_RS09660 (2023229) 2023229..2023309 - 81 Protein_1896 hypothetical protein -
QJP83_RS09665 (2023355) 2023355..2023549 - 195 WP_000988601.1 DUF5983 family protein -
QJP83_RS09670 (2023546) 2023546..2023920 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP83_RS09675 (2024009) 2024009..2024377 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP83_RS09680 (2024457) 2024457..2024678 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP83_RS09685 (2024741) 2024741..2025217 - 477 WP_001186773.1 RadC family protein -
QJP83_RS09690 (2025233) 2025233..2025706 - 474 WP_001385393.1 antirestriction protein -
QJP83_RS09695 (2025969) 2025969..2026790 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP83_RS09700 (2027011) 2027011..2027421 - 411 WP_000846704.1 hypothetical protein -
QJP83_RS09705 (2027437) 2027437..2028114 - 678 WP_001362823.1 hypothetical protein -
QJP83_RS09710 (2028250) 2028250..2029320 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279834 WP_000854814.1 NZ_CP124359:c2023920-2023546 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT279834 WP_001546021.1 NZ_CP124359:c2024377-2024009 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References