Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4531953..4532788 | Replicon | chromosome |
| Accession | NZ_CP124357 | ||
| Organism | Escherichia coli strain AVS0467 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VR61 |
| Locus tag | QJP58_RS22095 | Protein ID | WP_000854747.1 |
| Coordinates | 4532411..4532788 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A6A0PK89 |
| Locus tag | QJP58_RS22090 | Protein ID | WP_024186867.1 |
| Coordinates | 4531953..4532321 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP58_RS22055 (4527865) | 4527865..4528545 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QJP58_RS22060 (4528693) | 4528693..4529370 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP58_RS22065 (4529376) | 4529376..4529609 | + | 234 | WP_001278280.1 | DUF905 family protein | - |
| QJP58_RS22070 (4529699) | 4529699..4530517 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| QJP58_RS22075 (4530608) | 4530608..4531093 | + | 486 | WP_001588934.1 | antirestriction protein | - |
| QJP58_RS22080 (4531108) | 4531108..4531584 | + | 477 | WP_001588933.1 | RadC family protein | - |
| QJP58_RS22085 (4531653) | 4531653..4531874 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP58_RS22090 (4531953) | 4531953..4532321 | + | 369 | WP_024186867.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP58_RS22095 (4532411) | 4532411..4532788 | + | 378 | WP_000854747.1 | TA system toxin CbtA family protein | Toxin |
| QJP58_RS22100 (4532785) | 4532785..4533273 | + | 489 | WP_000761667.1 | DUF5983 family protein | - |
| QJP58_RS22105 (4533285) | 4533285..4533482 | + | 198 | WP_000839291.1 | DUF957 domain-containing protein | - |
| QJP58_RS22110 (4533567) | 4533567..4534421 | + | 855 | WP_001588930.1 | DUF4942 domain-containing protein | - |
| QJP58_RS22115 (4534739) | 4534739..4534898 | + | 160 | Protein_4338 | integrase | - |
| QJP58_RS22120 (4535158) | 4535158..4536696 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4519269..4560192 | 40923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14095.03 Da Isoelectric Point: 6.8524
>T279825 WP_000854747.1 NZ_CP124357:4532411-4532788 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13555.35 Da Isoelectric Point: 6.4745
>AT279825 WP_024186867.1 NZ_CP124357:4531953-4532321 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VFZ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6A0PK89 |