Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4039596..4040146 Replicon chromosome
Accession NZ_CP124357
Organism Escherichia coli strain AVS0467

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QJP58_RS19675 Protein ID WP_001160966.1
Coordinates 4039596..4039910 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJP58_RS19680 Protein ID WP_000125566.1
Coordinates 4039913..4040146 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP58_RS19650 (4035271) 4035271..4036557 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QJP58_RS19655 (4036557) 4036557..4037546 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJP58_RS19660 (4037543) 4037543..4038364 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJP58_RS19665 (4038367) 4038367..4038744 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJP58_RS19670 (4038751) 4038751..4039599 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJP58_RS19675 (4039596) 4039596..4039910 - 315 WP_001160966.1 CcdB family protein Toxin
QJP58_RS19680 (4039913) 4039913..4040146 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJP58_RS19685 (4040232) 4040232..4040711 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJP58_RS19690 (4040903) 4040903..4042765 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QJP58_RS19695 (4042758) 4042758..4043288 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJP58_RS19700 (4043396) 4043396..4044727 - 1332 WP_001183207.1 MFS transporter -
QJP58_RS19705 (4044786) 4044786..4045073 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T279822 WP_001160966.1 NZ_CP124357:c4039910-4039596 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279822 WP_000125566.1 NZ_CP124357:c4040146-4039913 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References