Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2013611..2014442 Replicon chromosome
Accession NZ_CP124357
Organism Escherichia coli strain AVS0467

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QJP58_RS09585 Protein ID WP_000854814.1
Coordinates 2013611..2013985 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QJP58_RS09590 Protein ID WP_001546021.1
Coordinates 2014074..2014442 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP58_RS09550 (2009606) 2009606..2009935 + 330 WP_000450409.1 DUF496 family protein -
QJP58_RS09555 (2010036) 2010036..2010359 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QJP58_RS09560 (2010338) 2010338..2010418 + 81 WP_023441679.1 hypothetical protein -
QJP58_RS09565 (2010629) 2010629..2012170 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QJP58_RS09570 (2012185) 2012185..2012931 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJP58_RS09575 (2013294) 2013294..2013374 - 81 Protein_1879 hypothetical protein -
QJP58_RS09580 (2013420) 2013420..2013614 - 195 WP_000988601.1 DUF5983 family protein -
QJP58_RS09585 (2013611) 2013611..2013985 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJP58_RS09590 (2014074) 2014074..2014442 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJP58_RS09595 (2014522) 2014522..2014743 - 222 WP_000692323.1 DUF987 domain-containing protein -
QJP58_RS09600 (2014806) 2014806..2015282 - 477 WP_001186773.1 RadC family protein -
QJP58_RS09605 (2015298) 2015298..2015771 - 474 WP_001385393.1 antirestriction protein -
QJP58_RS09610 (2016034) 2016034..2016855 - 822 WP_001234710.1 DUF932 domain-containing protein -
QJP58_RS09615 (2017076) 2017076..2017486 - 411 WP_000846704.1 hypothetical protein -
QJP58_RS09620 (2017502) 2017502..2018179 - 678 WP_001362823.1 hypothetical protein -
QJP58_RS09625 (2018315) 2018315..2019385 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T279812 WP_000854814.1 NZ_CP124357:c2013985-2013611 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT279812 WP_001546021.1 NZ_CP124357:c2014442-2014074 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References