Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 139351..139994 | Replicon | plasmid pAVS0171-A |
| Accession | NZ_CP124356 | ||
| Organism | Escherichia coli strain AVS0171 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QJB00_RS27030 | Protein ID | WP_001034044.1 |
| Coordinates | 139578..139994 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QJB00_RS27025 | Protein ID | WP_001261286.1 |
| Coordinates | 139351..139581 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB00_RS27005 (135982) | 135982..136737 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJB00_RS27010 (137459) | 137459..138265 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| QJB00_RS27015 (138266) | 138266..138571 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| QJB00_RS27020 (138573) | 138573..138791 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| QJB00_RS27025 (139351) | 139351..139581 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QJB00_RS27030 (139578) | 139578..139994 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QJB00_RS27035 (140069) | 140069..141634 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QJB00_RS27040 (141619) | 141619..142641 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| QJB00_RS27045 (143338) | 143338..143339 | - | 2 | WP_001743396.1 | IS1-like element IS1A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB / iutA / iutA / iutA / iutA / iutA / iucD / iucD | 1..149660 | 149660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T279804 WP_001034044.1 NZ_CP124356:139578-139994 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |