Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 138266..138791 Replicon plasmid pAVS0171-A
Accession NZ_CP124356
Organism Escherichia coli strain AVS0171

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QJB00_RS27015 Protein ID WP_001159871.1
Coordinates 138266..138571 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QJB00_RS27020 Protein ID WP_000813630.1
Coordinates 138573..138791 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB00_RS27000 (134228) 134228..135394 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
QJB00_RS27005 (135982) 135982..136737 - 756 WP_000852146.1 replication initiation protein RepE -
QJB00_RS27010 (137459) 137459..138265 - 807 WP_000016970.1 site-specific integrase -
QJB00_RS27015 (138266) 138266..138571 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QJB00_RS27020 (138573) 138573..138791 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QJB00_RS27025 (139351) 139351..139581 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QJB00_RS27030 (139578) 139578..139994 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QJB00_RS27035 (140069) 140069..141634 + 1566 WP_001128474.1 AAA family ATPase -
QJB00_RS27040 (141619) 141619..142641 + 1023 WP_000361402.1 helicase UvrD -
QJB00_RS27045 (143338) 143338..143339 - 2 WP_001743396.1 IS1-like element IS1A family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - senB / iutA / iutA / iutA / iutA / iutA / iucD / iucD 1..149660 149660


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T279803 WP_001159871.1 NZ_CP124356:c138571-138266 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT279803 WP_000813630.1 NZ_CP124356:c138791-138573 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References