Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3880160..3880680 Replicon chromosome
Accession NZ_CP124355
Organism Escherichia coli strain AVS0171

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QJB00_RS19065 Protein ID WP_001160964.1
Coordinates 3880396..3880680 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QJB00_RS19060 Protein ID WP_000125566.1
Coordinates 3880160..3880393 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB00_RS19035 (3875233) 3875233..3875520 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QJB00_RS19040 (3875579) 3875579..3876910 + 1332 WP_001183209.1 MFS transporter -
QJB00_RS19045 (3877018) 3877018..3877548 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QJB00_RS19050 (3877541) 3877541..3879403 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QJB00_RS19055 (3879595) 3879595..3880074 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QJB00_RS19060 (3880160) 3880160..3880393 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QJB00_RS19065 (3880396) 3880396..3880680 + 285 WP_001160964.1 CcdB family protein Toxin
QJB00_RS19070 (3880707) 3880707..3881555 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QJB00_RS19075 (3881562) 3881562..3881939 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QJB00_RS19080 (3881942) 3881942..3882763 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QJB00_RS19085 (3882760) 3882760..3883749 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QJB00_RS19090 (3883749) 3883749..3885035 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T279788 WP_001160964.1 NZ_CP124355:3880396-3880680 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT279788 WP_000125566.1 NZ_CP124355:3880160-3880393 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References