Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3686468..3687303 | Replicon | chromosome |
| Accession | NZ_CP124355 | ||
| Organism | Escherichia coli strain AVS0171 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QJB00_RS18130 | Protein ID | WP_000854759.1 |
| Coordinates | 3686926..3687303 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QJB00_RS18125 | Protein ID | WP_001295723.1 |
| Coordinates | 3686468..3686836 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB00_RS18100 (3683583) | 3683583..3683778 | + | 196 | Protein_3541 | DUF905 family protein | - |
| QJB00_RS18105 (3683896) | 3683896..3684714 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QJB00_RS18110 (3685056) | 3685056..3685529 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QJB00_RS18115 (3685545) | 3685545..3686021 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QJB00_RS18120 (3686084) | 3686084..3686305 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QJB00_RS18125 (3686468) | 3686468..3686836 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QJB00_RS18130 (3686926) | 3686926..3687303 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QJB00_RS18135 (3687300) | 3687300..3687788 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QJB00_RS18140 (3687805) | 3687805..3687981 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QJB00_RS18145 (3688087) | 3688087..3688236 | + | 150 | Protein_3550 | hypothetical protein | - |
| QJB00_RS18150 (3688695) | 3688695..3690236 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QJB00_RS18155 (3690251) | 3690251..3690997 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QJB00_RS18160 (3691189) | 3691189..3691365 | + | 177 | Protein_3553 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3672773..3701535 | 28762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T279786 WP_000854759.1 NZ_CP124355:3686926-3687303 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT279786 WP_001295723.1 NZ_CP124355:3686468-3686836 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |