Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3589655..3590250 | Replicon | chromosome |
Accession | NZ_CP124355 | ||
Organism | Escherichia coli strain AVS0171 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | QJB00_RS17635 | Protein ID | WP_000239579.1 |
Coordinates | 3589900..3590250 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | QJB00_RS17630 | Protein ID | WP_001223208.1 |
Coordinates | 3589655..3589906 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB00_RS17620 (3585320) | 3585320..3589099 | + | 3780 | WP_000060945.1 | autotransporter assembly complex protein TamB | - |
QJB00_RS17625 (3589102) | 3589102..3589443 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
QJB00_RS17630 (3589655) | 3589655..3589906 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
QJB00_RS17635 (3589900) | 3589900..3590250 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
QJB00_RS17640 (3590330) | 3590330..3590860 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
QJB00_RS17645 (3591170) | 3591170..3592126 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
QJB00_RS17650 (3592266) | 3592266..3593768 | + | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
QJB00_RS17655 (3593782) | 3593782..3594804 | + | 1023 | WP_001296689.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T279785 WP_000239579.1 NZ_CP124355:3589900-3590250 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |