Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3386197..3386998 Replicon chromosome
Accession NZ_CP124355
Organism Escherichia coli strain AVS0171

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QJB00_RS16605 Protein ID WP_001094436.1
Coordinates 3386197..3386574 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QJB00_RS16610 Protein ID WP_015953067.1
Coordinates 3386621..3386998 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB00_RS16575 (3382156) 3382156..3382317 - 162 Protein_3241 DUF4942 domain-containing protein -
QJB00_RS16580 (3382408) 3382408..3383907 + 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
QJB00_RS16585 (3383904) 3383904..3384659 + 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
QJB00_RS16590 (3384708) 3384708..3385418 - 711 WP_001621817.1 DUF4942 domain-containing protein -
QJB00_RS16595 (3385503) 3385503..3385700 - 198 WP_000839254.1 DUF957 domain-containing protein -
QJB00_RS16600 (3385712) 3385712..3386200 - 489 WP_000761714.1 DUF5983 family protein -
QJB00_RS16605 (3386197) 3386197..3386574 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QJB00_RS16610 (3386621) 3386621..3386998 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QJB00_RS16615 (3387077) 3387077..3387298 - 222 WP_000692312.1 DUF987 domain-containing protein -
QJB00_RS16620 (3387367) 3387367..3387843 - 477 WP_001186756.1 RadC family protein -
QJB00_RS16625 (3387858) 3387858..3388343 - 486 WP_029700724.1 antirestriction protein -
QJB00_RS16630 (3388435) 3388435..3389253 - 819 WP_001175163.1 DUF932 domain-containing protein -
QJB00_RS16635 (3389343) 3389343..3389576 - 234 WP_001278287.1 DUF905 family protein -
QJB00_RS16640 (3389582) 3389582..3390259 - 678 WP_001097301.1 hypothetical protein -
QJB00_RS16645 (3390407) 3390407..3391087 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T279784 WP_001094436.1 NZ_CP124355:c3386574-3386197 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT279784 WP_015953067.1 NZ_CP124355:c3386998-3386621 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References