Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2035116..2035950 Replicon chromosome
Accession NZ_CP124355
Organism Escherichia coli strain AVS0171

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QJB00_RS10185 Protein ID WP_000854690.1
Coordinates 2035573..2035950 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QJB00_RS10180 Protein ID WP_001305076.1
Coordinates 2035116..2035484 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB00_RS10140 (2030198) 2030198..2031325 + 1128 Protein_1994 hypothetical protein -
QJB00_RS10145 (2031401) 2031401..2031856 + 456 WP_000581502.1 IrmA family protein -
QJB00_RS10150 (2031935) 2031935..2032168 + 234 WP_000902034.1 DUF905 family protein -
QJB00_RS10155 (2032269) 2032269..2033087 + 819 WP_001234620.1 DUF932 domain-containing protein -
QJB00_RS10160 (2033142) 2033142..2033627 + 486 WP_000849565.1 antirestriction protein -
QJB00_RS10165 (2033643) 2033643..2034119 + 477 WP_001186726.1 RadC family protein -
QJB00_RS10170 (2034182) 2034182..2034403 + 222 WP_000692329.1 DUF987 domain-containing protein -
QJB00_RS10175 (2034422) 2034422..2035066 + 645 WP_000094916.1 hypothetical protein -
QJB00_RS10180 (2035116) 2035116..2035484 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJB00_RS10185 (2035573) 2035573..2035950 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QJB00_RS10190 (2035947) 2035947..2036435 + 489 WP_000761699.1 DUF5983 family protein -
QJB00_RS10195 (2036452) 2036452..2036649 + 198 WP_000839293.1 DUF957 domain-containing protein -
QJB00_RS10200 (2036734) 2036734..2037579 + 846 WP_001529401.1 DUF4942 domain-containing protein -
QJB00_RS10205 (2037648) 2037648..2038043 + 396 WP_000208384.1 DUF6088 family protein -
QJB00_RS10210 (2038036) 2038036..2038969 + 934 Protein_2008 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QJB00_RS10215 (2039386) 2039386..2039556 + 171 Protein_2009 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2039401..2039556 155
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT / kpsM / gspM 2033643..2059277 25634


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T279778 WP_000854690.1 NZ_CP124355:2035573-2035950 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT279778 WP_001305076.1 NZ_CP124355:2035116-2035484 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References