Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 866312..867143 Replicon chromosome
Accession NZ_CP124355
Organism Escherichia coli strain AVS0171

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QJB00_RS04580 Protein ID WP_000854815.1
Coordinates 866769..867143 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QJB00_RS04575 Protein ID WP_001280918.1
Coordinates 866312..866680 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJB00_RS04530 (861401) 861401..862147 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QJB00_RS04535 (862230) 862230..862580 + 351 Protein_895 hypothetical protein -
QJB00_RS04540 (862596) 862596..863006 + 411 WP_000846703.1 hypothetical protein -
QJB00_RS04545 (863227) 863227..864045 + 819 WP_001542275.1 DUF932 domain-containing protein -
QJB00_RS04550 (864045) 864045..864290 + 246 WP_001164966.1 hypothetical protein -
QJB00_RS04555 (864384) 864384..864857 + 474 WP_001542276.1 antirestriction protein -
QJB00_RS04560 (864873) 864873..865349 + 477 WP_001186200.1 RadC family protein -
QJB00_RS04565 (865412) 865412..865633 + 222 WP_000692345.1 DUF987 domain-containing protein -
QJB00_RS04570 (865652) 865652..866296 + 645 WP_000086752.1 hypothetical protein -
QJB00_RS04575 (866312) 866312..866680 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QJB00_RS04580 (866769) 866769..867143 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QJB00_RS04585 (867140) 867140..867334 + 195 WP_000988600.1 DUF5983 family protein -
QJB00_RS04590 (867380) 867380..867460 + 81 Protein_906 hypothetical protein -
QJB00_RS04595 (867749) 867749..867829 - 81 WP_023441679.1 hypothetical protein -
QJB00_RS04600 (867808) 867808..868131 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QJB00_RS04605 (868232) 868232..868561 - 330 WP_000450409.1 DUF496 family protein -
QJB00_RS04610 (868733) 868733..869791 - 1059 WP_001200889.1 FUSC family protein -
QJB00_RS04615 (869989) 869989..870462 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QJB00_RS04620 (870581) 870581..871747 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 804773..915047 110274


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T279775 WP_000854815.1 NZ_CP124355:866769-867143 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT279775 WP_001280918.1 NZ_CP124355:866312-866680 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References