Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 866312..867143 | Replicon | chromosome |
Accession | NZ_CP124355 | ||
Organism | Escherichia coli strain AVS0171 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A066T988 |
Locus tag | QJB00_RS04580 | Protein ID | WP_000854815.1 |
Coordinates | 866769..867143 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
Locus tag | QJB00_RS04575 | Protein ID | WP_001280918.1 |
Coordinates | 866312..866680 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJB00_RS04530 (861401) | 861401..862147 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
QJB00_RS04535 (862230) | 862230..862580 | + | 351 | Protein_895 | hypothetical protein | - |
QJB00_RS04540 (862596) | 862596..863006 | + | 411 | WP_000846703.1 | hypothetical protein | - |
QJB00_RS04545 (863227) | 863227..864045 | + | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
QJB00_RS04550 (864045) | 864045..864290 | + | 246 | WP_001164966.1 | hypothetical protein | - |
QJB00_RS04555 (864384) | 864384..864857 | + | 474 | WP_001542276.1 | antirestriction protein | - |
QJB00_RS04560 (864873) | 864873..865349 | + | 477 | WP_001186200.1 | RadC family protein | - |
QJB00_RS04565 (865412) | 865412..865633 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
QJB00_RS04570 (865652) | 865652..866296 | + | 645 | WP_000086752.1 | hypothetical protein | - |
QJB00_RS04575 (866312) | 866312..866680 | + | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QJB00_RS04580 (866769) | 866769..867143 | + | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
QJB00_RS04585 (867140) | 867140..867334 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
QJB00_RS04590 (867380) | 867380..867460 | + | 81 | Protein_906 | hypothetical protein | - |
QJB00_RS04595 (867749) | 867749..867829 | - | 81 | WP_023441679.1 | hypothetical protein | - |
QJB00_RS04600 (867808) | 867808..868131 | + | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
QJB00_RS04605 (868232) | 868232..868561 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
QJB00_RS04610 (868733) | 868733..869791 | - | 1059 | WP_001200889.1 | FUSC family protein | - |
QJB00_RS04615 (869989) | 869989..870462 | - | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
QJB00_RS04620 (870581) | 870581..871747 | - | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 804773..915047 | 110274 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T279775 WP_000854815.1 NZ_CP124355:866769-867143 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A066T988 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061Y7A8 |