Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4331545..4332163 | Replicon | chromosome |
| Accession | NZ_CP124353 | ||
| Organism | Escherichia coli strain AVS0226 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QJP71_RS21215 | Protein ID | WP_001291435.1 |
| Coordinates | 4331545..4331763 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QJP71_RS21220 | Protein ID | WP_000344800.1 |
| Coordinates | 4331789..4332163 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP71_RS21180 (4326832) | 4326832..4327404 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| QJP71_RS21185 (4327435) | 4327435..4327746 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| QJP71_RS21195 (4328125) | 4328125..4328478 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
| QJP71_RS21200 (4328520) | 4328520..4330070 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QJP71_RS21205 (4330234) | 4330234..4330704 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| QJP71_RS21210 (4330820) | 4330820..4331371 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QJP71_RS21215 (4331545) | 4331545..4331763 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QJP71_RS21220 (4331789) | 4331789..4332163 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QJP71_RS21225 (4332709) | 4332709..4335858 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QJP71_RS21230 (4335881) | 4335881..4337074 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279755 WP_001291435.1 NZ_CP124353:c4331763-4331545 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT279755 WP_000344800.1 NZ_CP124353:c4332163-4331789 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |