Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3386113..3386914 | Replicon | chromosome |
| Accession | NZ_CP124353 | ||
| Organism | Escherichia coli strain AVS0226 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | QJP71_RS16605 | Protein ID | WP_001094436.1 |
| Coordinates | 3386113..3386490 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | QJP71_RS16610 | Protein ID | WP_015953067.1 |
| Coordinates | 3386537..3386914 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP71_RS16575 (3382072) | 3382072..3382233 | - | 162 | Protein_3241 | DUF4942 domain-containing protein | - |
| QJP71_RS16580 (3382324) | 3382324..3383823 | + | 1500 | WP_029700729.1 | IS21-like element ISEc10 family transposase | - |
| QJP71_RS16585 (3383820) | 3383820..3384575 | + | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| QJP71_RS16590 (3384624) | 3384624..3385334 | - | 711 | WP_001621817.1 | DUF4942 domain-containing protein | - |
| QJP71_RS16595 (3385419) | 3385419..3385616 | - | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| QJP71_RS16600 (3385628) | 3385628..3386116 | - | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QJP71_RS16605 (3386113) | 3386113..3386490 | - | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| QJP71_RS16610 (3386537) | 3386537..3386914 | - | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QJP71_RS16615 (3386993) | 3386993..3387214 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QJP71_RS16620 (3387283) | 3387283..3387759 | - | 477 | WP_001186756.1 | RadC family protein | - |
| QJP71_RS16625 (3387774) | 3387774..3388259 | - | 486 | WP_029700724.1 | antirestriction protein | - |
| QJP71_RS16630 (3388351) | 3388351..3389169 | - | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
| QJP71_RS16635 (3389259) | 3389259..3389492 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QJP71_RS16640 (3389498) | 3389498..3390175 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| QJP71_RS16645 (3390323) | 3390323..3391003 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T279749 WP_001094436.1 NZ_CP124353:c3386490-3386113 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT279749 WP_015953067.1 NZ_CP124353:c3386914-3386537 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |