Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 95594..96237 | Replicon | plasmid pAVS0362-A |
Accession | NZ_CP124352 | ||
Organism | Escherichia coli strain AVS0362 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | QJP84_RS26765 | Protein ID | WP_001034044.1 |
Coordinates | 95821..96237 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | QJP84_RS26760 | Protein ID | WP_001261286.1 |
Coordinates | 95594..95824 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP84_RS26740 (92225) | 92225..92980 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QJP84_RS26745 (93702) | 93702..94508 | - | 807 | WP_000016970.1 | site-specific integrase | - |
QJP84_RS26750 (94509) | 94509..94814 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
QJP84_RS26755 (94816) | 94816..95034 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
QJP84_RS26760 (95594) | 95594..95824 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QJP84_RS26765 (95821) | 95821..96237 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QJP84_RS26770 (96312) | 96312..97877 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
QJP84_RS26775 (97862) | 97862..98884 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | iutA / iutA / iucD | 1..105909 | 105909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T279734 WP_001034044.1 NZ_CP124352:95821-96237 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |