Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 94509..95034 | Replicon | plasmid pAVS0362-A |
| Accession | NZ_CP124352 | ||
| Organism | Escherichia coli strain AVS0362 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | QJP84_RS26750 | Protein ID | WP_001159871.1 |
| Coordinates | 94509..94814 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | QJP84_RS26755 | Protein ID | WP_000813630.1 |
| Coordinates | 94816..95034 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP84_RS26735 (90471) | 90471..91637 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QJP84_RS26740 (92225) | 92225..92980 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QJP84_RS26745 (93702) | 93702..94508 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| QJP84_RS26750 (94509) | 94509..94814 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QJP84_RS26755 (94816) | 94816..95034 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QJP84_RS26760 (95594) | 95594..95824 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QJP84_RS26765 (95821) | 95821..96237 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| QJP84_RS26770 (96312) | 96312..97877 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| QJP84_RS26775 (97862) | 97862..98884 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iutA / iucD | 1..105909 | 105909 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T279733 WP_001159871.1 NZ_CP124352:c94814-94509 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |